Loading...
Statistics
Advertisement

Acrylic-sheet.net

Advertisement
Conversion Technology Metas Server
Acrylic-sheet.net is hosted in United States / Scottsdale . Acrylic-sheet.net doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Iframe, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Acrylic-sheet.net

Technology

Number of occurences: 3
  • Html
  • Html5
  • Iframe

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Acrylic-sheet.net

Missing HTTPS protocol.

    Meta - Acrylic-sheet.net

    Number of occurences: 0

    Server / Hosting

    • IP: 50.63.202.52
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns06.domaincontrol.com
    • ns05.domaincontrol.com
    • mailstore1.secureserver.net
    • smtp.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Cache-Control: no-cache Pragma: no-cache Content-Type: text/html; charset=utf-8 Expires: -1 Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Wed, 17 Aug 2016 07:41:25 GMT Content-Length: 299 Age: 1 X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive

    DNS

    host: acrylic-sheet.net
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 50.63.202.52
    host: acrylic-sheet.net
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns06.domaincontrol.com
    host: acrylic-sheet.net
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns05.domaincontrol.com
    host: acrylic-sheet.net
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns05.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016050200
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 3600
    host: acrylic-sheet.net
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net
    host: acrylic-sheet.net
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.crylic-sheet.net, www.aocrylic-sheet.net, www.ocrylic-sheet.net, www.apcrylic-sheet.net, www.pcrylic-sheet.net, www.a9crylic-sheet.net, www.9crylic-sheet.net, www.acrylic-sheet.net, www.crylic-sheet.net, www.aicrylic-sheet.net, www.icrylic-sheet.net, www.aucrylic-sheet.net, www.ucrylic-sheet.net, www.arylic-sheet.net, www.acdrylic-sheet.net, www.adrylic-sheet.net, www.acrrylic-sheet.net, www.arrylic-sheet.net, www.actrylic-sheet.net, www.atrylic-sheet.net, www.acvrylic-sheet.net, www.avrylic-sheet.net, www.acfrylic-sheet.net, www.afrylic-sheet.net, www.acgrylic-sheet.net, www.agrylic-sheet.net, www.achrylic-sheet.net, www.ahrylic-sheet.net, www.acnrylic-sheet.net, www.anrylic-sheet.net, www.acmrylic-sheet.net, www.amrylic-sheet.net, www.acjrylic-sheet.net, www.ajrylic-sheet.net, www.acylic-sheet.net, www.acriylic-sheet.net, www.aciylic-sheet.net, www.acroylic-sheet.net, www.acoylic-sheet.net, www.acrlylic-sheet.net, www.aclylic-sheet.net, www.acrlylic-sheet.net, www.aclylic-sheet.net, www.acr.ylic-sheet.net, www.ac.ylic-sheet.net, www.acrlic-sheet.net, www.acryzlic-sheet.net, www.acrzlic-sheet.net, www.acryalic-sheet.net, www.acralic-sheet.net, www.acryslic-sheet.net, www.acrslic-sheet.net, www.acrydlic-sheet.net, www.acrdlic-sheet.net, www.acrylic-sheet.net, www.acrlic-sheet.net, www.acryclic-sheet.net, www.acrclic-sheet.net, www.acry lic-sheet.net, www.acr lic-sheet.net, www.acryic-sheet.net, www.acryluic-sheet.net, www.acryuic-sheet.net, www.acryl8ic-sheet.net, www.acry8ic-sheet.net, www.acryl9ic-sheet.net, www.acry9ic-sheet.net, www.acryljic-sheet.net, www.acryjic-sheet.net, www.acryl0ic-sheet.net, www.acry0ic-sheet.net, www.acrylmic-sheet.net, www.acrymic-sheet.net, www.acrylpic-sheet.net, www.acrypic-sheet.net, www.acryloic-sheet.net, www.acryoic-sheet.net, www.acrylc-sheet.net, www.acrylirc-sheet.net, www.acrylrc-sheet.net, www.acrylifc-sheet.net, www.acrylfc-sheet.net, www.acrylivc-sheet.net, www.acrylvc-sheet.net, www.acrylikc-sheet.net, www.acrylkc-sheet.net, www.acryli,c-sheet.net, www.acryl,c-sheet.net, www.acrylibc-sheet.net, www.acrylbc-sheet.net, www.acryligc-sheet.net, www.acrylgc-sheet.net, www.acrylitc-sheet.net, www.acryltc-sheet.net, www.acryliyc-sheet.net, www.acrylyc-sheet.net, www.acryliuc-sheet.net, www.acryluc-sheet.net, www.acrylijc-sheet.net, www.acryljc-sheet.net, www.acrylimc-sheet.net, www.acrylmc-sheet.net, www.acrylinc-sheet.net, www.acrylnc-sheet.net, www.acryli-sheet.net, www.acrylicd-sheet.net, www.acrylid-sheet.net, www.acrylicr-sheet.net, www.acrylir-sheet.net, www.acrylict-sheet.net, www.acrylit-sheet.net, www.acrylicv-sheet.net, www.acryliv-sheet.net, www.acrylicf-sheet.net, www.acrylif-sheet.net, www.acrylicg-sheet.net, www.acrylig-sheet.net, www.acrylich-sheet.net, www.acrylih-sheet.net, www.acrylicn-sheet.net, www.acrylin-sheet.net, www.acrylicm-sheet.net, www.acrylim-sheet.net, www.acrylicj-sheet.net, www.acrylij-sheet.net, www.acrylicsheet.net, www.acrylic-tsheet.net, www.acrylictsheet.net, www.acrylic-gsheet.net, www.acrylicgsheet.net, www.acrylic-hsheet.net, www.acrylichsheet.net, www.acrylic-usheet.net, www.acrylicusheet.net, www.acrylic-jsheet.net, www.acrylicjsheet.net, www.acrylic-xsheet.net, www.acrylicxsheet.net, www.acrylic-ssheet.net, www.acrylicssheet.net, www.acrylic-asheet.net, www.acrylicasheet.net, www.acrylic-sheet.net, www.acrylicsheet.net, www.acrylic- sheet.net, www.acrylic sheet.net, www.acrylic-heet.net, www.acrylic-seheet.net, www.acrylic-eheet.net, www.acrylic-swheet.net, www.acrylic-wheet.net, www.acrylic-sdheet.net, www.acrylic-dheet.net, www.acrylic-sxheet.net, www.acrylic-xheet.net, www.acrylic-sfheet.net, www.acrylic-fheet.net, www.acrylic-sgheet.net, www.acrylic-gheet.net, www.acrylic-stheet.net, www.acrylic-theet.net,

    Other websites we recently analyzed

    1. Siel Bleu Home - Siel Bleu Ireland
      France - 213.186.33.82
      Server software: Apache
      Technology: BootstrapCDN, Maxcdn, Carousel, CSS, Datepicker, Flexslider, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery Colorbox, jQuery Fancybox, jQuery Validate, Php, Pingback, Shortcodes, Wordpress
      Number of Javascript: 37
      Number of meta tags: 3
    2. وب سايت توانمندي
      Iran, Islamic Republic of - 5.144.130.33
      Server software: Apache
      Technology: CSS, Html, Html5, jQuery, Php, Pingback, Swf Object, Wordpress
      Number of Javascript: 4
      Number of meta tags: 2
    3. porshacjackson
      Ashburn (United States) - 54.83.179.144
      Server software: Pepyaka/1.9.13
      Technology: CSS, Html, Html5, Javascript, Wix
      Number of Javascript: 2
      Number of meta tags: 5
    4.  
      Ashburn (United States) - 52.0.217.44
      Server software:
      Technology: CSS, Google Font API, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    5. rostocker-fruehling – Initiative für Demokratie und Umweltschutz
      diese website ist grad in Überarbeitung ...   Rettet die Natur in den Wall-Anlagen vor den Umbauten! Liebe Freundinnen und Freunde des rostocker frühling, kommt alle zum Bürgerforum zum Thema Wallanlagen: die Planungen zur Dreiwallbastion und zur Heubastion werden vorgestellt und diskutiert: am Dienstag, 11. August 2015, um 17:00 Uhr, im Kulturhistorischen Museum, im Kapitelsaal.…
      San Francisco (United States) - 192.0.78.13
      Server software: Apache
      Technology: Skimlinks, CSS, Google Font API, Gravatar, Html, Html5, Javascript, Php, Pingback, comScore, Wordpress
      Number of Javascript: 6
      Number of meta tags: 12
    6. Get Money Empire Inc. - Home
      San Francisco (United States) - 199.34.228.68
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 5
      Number of meta tags: 1
    7. vuki.science
      Austin (United States) - 209.99.40.219
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    8. Huron Valley Cabling and Consulting
      Business for Telephone and Computer Cabling
      Mountain View (United States) - 74.125.206.121
      Server software: ghs
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 3
    9. physiciansadvancedfitnessmedicine.com
      Provo (United States) - 198.57.247.164
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    10. Sie werden weitergeleitet auf
      Germany - 134.119.245.118
      Server software: Apache/2.4.20
      Technology: Php
      Number of meta tags: 1

    Check Other Websites